Short info
Price
1715 EUR
Size
500 ug
Catalog no.:
CR40-500
We guarantee fast shipment of Pdgf-BB products. Our specialists will be happy to answer all of your questions.
Product description
Species reactivity
Mouse
UniProt number
P31240
Estimated molecular weight
13,4 kDa
Group
recombinants
Latin name
Mus musculus
Origin
Escherichia coli
Shipping condition
Ambient/Room Temperature
Source
Recombinants or rec. proteins
Protein purity
Greater than 95% as determined by reducing SDS-PAGE.
Package form
Lyophilized from a 0.2 µm filtered solution of 4mM HCl.
Endotoxin level
Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Peptide sequence
MSLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVVTPRPVTLEHHHHHH
Description
Recombinant Mouse Platelet-derived Growth Factor Subunit B is produced by our E.coli expression system and the target gene encoding Ser82-Thr190 is expressed with a 6His tag at the C-terminus.
Storage conditions
Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
Reconstitution conditions
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Test
Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
Additional description
Aplha, transcription related growth factors and stimulating factors or repressing nuclear factors are complex subunits of proteins involved in cell differentiation. Complex subunit associated factors are involved in hybridoma growth, Eosinohils, eritroid proliferation and derived from promotor binding stimulating subunits on the DNA binding complex. NFKB 105 subunit for example is a polypetide gene enhancer of genes in B cells.Platelets, also called thrombocytes or cloth cells in blood and are needed to stop bleeding by clumping and clotting the blood the vessels when the an injury occurs. Teh bone marrow will produce the platelets that have no nucleus. Platelates are unique to mammals, the are curved shaped 1900nm to 3100 nm large nucleus free clothing structures.