Recombinant Mouse Platelet-derived Growth Factor Subunit B/PDGF-BB(C-6His)

The best Pdgf-BB products, the best prices, high quality.

Short info

Price

2486 EUR

Size

1 mg

Catalog no.:

CR40-1000

We guarantee fast shipment of Pdgf-BB products. Our specialists will be happy to answer all of your questions.

Get from Gentaur.com

Product description

Species reactivity

Mouse

UniProt number

P31240

Estimated molecular weight

13,4 kDa

Group

recombinants

Latin name

Mus musculus

Origin

Escherichia coli

Shipping condition

Ambient/Room Temperature

Source

Recombinants or rec. proteins

Protein purity

Greater than 95% as determined by reducing SDS-PAGE.

Package form

Lyophilized from a 0.2 µm filtered solution of 4mM HCl.

Endotoxin level

Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

Peptide sequence

MSLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVVTPRPVTLEHHHHHH

Description

Recombinant Mouse Platelet-derived Growth Factor Subunit B is produced by our E.coli expression system and the target gene encoding Ser82-Thr190 is expressed with a 6His tag at the C-terminus.

Storage conditions

Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 3 months.

Reconstitution conditions

Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Test

Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.

Additional description

Aplha, transcription related growth factors and stimulating factors or repressing nuclear factors are complex subunits of proteins involved in cell differentiation. Complex subunit associated factors are involved in hybridoma growth, Eosinohils, eritroid proliferation and derived from promotor binding stimulating subunits on the DNA binding complex. NFKB 105 subunit for example is a polypetide gene enhancer of genes in B cells.Platelets, also called thrombocytes or cloth cells in blood and are needed to stop bleeding by clumping and clotting the blood the vessels when the an injury occurs. Teh bone marrow will produce the platelets that have no nucleus. Platelates are unique to mammals, the are curved shaped 1900nm to 3100 nm large nucleus free clothing structures.