Short info
Price
2283 EUR
Size
1 mg
Catalog no.:
C199-1000
We guarantee fast shipment of Pdgf-BB products. Our specialists will be happy to answer all of your questions.
Product description
Species reactivity
Human
UniProt number
P01127
Estimated molecular weight
12,42 kDa
Group
recombinants
Origin
Escherichia coli
Shipping condition
Ambient/Room Temperature
Source
Recombinants or rec. proteins
Protein purity
Greater than 95% as determined by reducing SDS-PAGE.
Package form
Lyophilized from a 0.2 µm filtered solution of 4mM HCl.
Endotoxin level
Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Peptide sequence
MSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT
Description
Recombinant Human Platelet-Derived Growth Factor BB is produced by our E.coli expression system and the target gene encoding Ser82-Thr190 is expressed.
Storage conditions
Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 3 months.
Reconstitution conditions
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Properties
Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
Additional description
Aplha, transcription related growth factors and stimulating factors or repressing nuclear factors are complex subunits of proteins involved in cell differentiation. Complex subunit associated factors are involved in hybridoma growth, Eosinohils, eritroid proliferation and derived from promotor binding stimulating subunits on the DNA binding complex. NFKB 105 subunit for example is a polypetide gene enhancer of genes in B cells.Platelets, also called thrombocytes or cloth cells in blood and are needed to stop bleeding by clumping and clotting the blood the vessels when the an injury occurs. Teh bone marrow will produce the platelets that have no nucleus. Platelates are unique to mammals, the are curved shaped 1900nm to 3100 nm large nucleus free clothing structures.